PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_32110-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 225aa    MW: 25880.9 Da    PI: 7.3025
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_32110-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.37.6e-184184146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg++T++E++l++d++ ++G++ W++Ia++++ gRt++++k++w++
  TRIUR3_32110-P1 41 RGNFTADEQLLILDLHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 84
                     89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.97E-222194IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-112147IPR009057Homeodomain-like
PROSITE profilePS500904.3562235IPR017877Myb-like domain
PROSITE profilePS5129423.863690IPR017930Myb domain
SMARTSM007171.2E-154088IPR001005SANT/Myb domain
PfamPF002492.8E-164184IPR001005SANT/Myb domain
CDDcd001671.65E-114384No hitNo description
Gene3DG3DSA:1.10.10.609.9E-204885IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MVIVVHAAEQ RRDHAVLRGL KRTGKSCRLR WLNYLRPDVK RGNFTADEQL LILDLHSRWG  60
NRWSKIAQHL PGRTDNEIKN YWRTRVQKHA KQLNCDANST KFKDAMKYLW MPRLADHHLQ  120
QASTVGDHLV PGPPTAYMES SGMVTSSSDS FASESYDGAR CANASVGEMI HSGDWVQEQN  180
QGFWPETNQN FQLQDSELSG WVQGFSESDS LAENFWSLED IWKMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-1718815103MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3605510.0AK360551.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1120I18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579302.11e-98PREDICTED: transcription factor MYB108-like isoform X1
TrEMBLM8AKK01e-171M8AKK0_TRIUA; Transcription factor MYB21
STRINGMLOC_6821.21e-138(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-57myb domain protein 62